PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI03G09920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 242aa    MW: 25320 Da    PI: 10.5701
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI03G09920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-172872348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd+ll ++v++ Gg++W  Ia  ++ gRt+k+c++rw+++l
  ORUFI03G09920.1 28 GWSKEEDKLLRELVRKQGGKDWGVIATAFP-GRTDKSCRLRWRQHL 72
                     5*****************************.************996 PP

2Myb_DNA-binding49.41.1e-1580124248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +++++ Ed ++v++++ +G++ W+tIa+ ++ gR+++ +k+rw+++l
  ORUFI03G09920.1  80 LPFSAGEDRKIVELHRVHGNR-WATIAAFLP-GRSDNAIKNRWNTHL 124
                      589999***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.3352176IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.9E-192575IPR009057Homeodomain-like
SMARTSM007176.7E-172574IPR001005SANT/Myb domain
SuperFamilySSF466891.57E-2925120IPR009057Homeodomain-like
PfamPF002491.7E-162872IPR001005SANT/Myb domain
CDDcd001671.46E-162972No hitNo description
SMARTSM007174.9E-1378126IPR001005SANT/Myb domain
PfamPF002499.3E-1481124IPR001005SANT/Myb domain
PROSITE profilePS5129419.00681128IPR017930Myb domain
CDDcd001671.33E-1281124No hitNo description
Gene3DG3DSA:1.10.10.609.3E-2181125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MALEGAAGGG GVGGGGGPPG QEAGKKVGWS KEEDKLLREL VRKQGGKDWG VIATAFPGRT  60
DKSCRLRWRQ HLDPSVDVAL PFSAGEDRKI VELHRVHGNR WATIAAFLPG RSDNAIKNRW  120
NTHLRKRHAQ DVQQRPSGGL ALGLGGGGGA GQAAGGKLTP VCLQLFPPTQ APPIGENLPG  180
PARSAVPELL KLFPLAPGDL KDNASAAAAM DVGNEAVRAL PELRLSPAAV VFDAMPLQAI  240
RM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-292912710107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1376960.0AC137696.2 Genomic sequence for Oryza sativa, Nipponbare strain, clone OSJNBa0049C20, from chromosome 3, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630256.11e-172PREDICTED: transcription factor WER-like
TrEMBLA0A0D3FFY01e-172A0A0D3FFY0_9ORYZ; Uncharacterized protein
TrEMBLA2XEB41e-172A2XEB4_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0GJC91e-172A0A0E0GJC9_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NS471e-172A0A0E0NS47_ORYRU; Uncharacterized protein
TrEMBLI1P9891e-172I1P989_ORYGL; Uncharacterized protein
TrEMBLQ10PF51e-172Q10PF5_ORYSJ; Myb-like DNA-binding domain containing protein, expressed
STRINGBGIOSGA012194-PA1e-172(Oryza sativa Indica Group)
STRINGLOC_Os03g13310.11e-172(Oryza sativa Japonica Group)
STRINGORGLA03G0093500.11e-172(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.12e-34myb domain protein 109